Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PATL2 Rabbit Polyclonal Antibody (HRP)

PATL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OOMD4, Pat1a, hPat1a

UniProt

C9JE40

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PATL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQLLEIEEGWKYRPPPPCFSEQQSNQVEKLFQTLKTQEQNNLEEAADGFL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Bcl2 Modifying Factor ELISA Kit
MBS006513 Inquire

Chicken Bcl2 Modifying Factor ELISA Kit

Sign In for Pricing
View Details
USP6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2596405 3x 1.0 µg

USP6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Hist1h1d sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4005802 1.0 µg DNA

Hist1h1d sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PTEN Tumor Suppressor Protein (MMAC1, Phosphatase and Tensin, TEP1) (Biotin) discontinued
P9182-03A-Biotin 100 µL

PTEN Tumor Suppressor Protein (MMAC1, Phosphatase and Tensin, TEP1) (Biotin) discontinued

Sign In for Pricing
View Details
Bovine Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2(NOX2) ELISA Kit
MBS2610049-01 48 Well

Bovine Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2(NOX2) ELISA Kit

Sign In for Pricing
View Details
Bovine Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2(NOX2) ELISA Kit
MBS2610049-02 96 Well

Bovine Nicotinamide Adenine Dinucleotide Phosphate Oxidase 2(NOX2) ELISA Kit

Sign In for Pricing
View Details