Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIH1D1 Rabbit Polyclonal Antibody (HRP)

PIH1D1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pih1, MOT48, NOP17, DNAAF14

UniProt

Q9NWS0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PIH1D1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Chlamydia Trachomatis Lps Antibody (1312/284) [Janelia Fluor 646]
NBP1-28820JF646 0.1 mL

Mouse Monoclonal Chlamydia Trachomatis Lps Antibody (1312/284) [Janelia Fluor 646]

Sign In for Pricing
View Details
OR2S1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1497806 1.0 µg DNA

OR2S1P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Na+/K+-ATPase β1 (E-4) Alexa Fluor® 594
sc-376406 AF594 200 µg/mL

Na+/K+-ATPase β1 (E-4) Alexa Fluor® 594

Sign In for Pricing
View Details
B-D-Glucopyranosyl fluoride
MG11187 1 g

B-D-Glucopyranosyl fluoride

Sign In for Pricing
View Details
GPR75 sgRNA CRISPR Lentivector (Human) (Target 2)
K0892803 1.0 µg DNA

GPR75 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ONECUT3, CT (ONECUT3, One cut domain family member 3, One cut homeobox 3, Transcription factor ONECUT-3)
039284 200 µL

ONECUT3, CT (ONECUT3, One cut domain family member 3, One cut homeobox 3, Transcription factor ONECUT-3)

Sign In for Pricing
View Details