Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R9A Rabbit Polyclonal Antibody (FITC)

PPP1R9A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NRB1, NRBI, Neurabin-I

UniProt

B2RWQ1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPP1R9A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

151kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001159632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8a Mouse Monoclonal Antibody (SK1), CF®660C Conjugate - Biotium Choice
P009-660C-500 1x 500 µL

CD8a Mouse Monoclonal Antibody (SK1), CF®660C Conjugate - Biotium Choice

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: bilateral
CB527218 1 Block

Frozen Tissue Blocks, Ovary: bilateral

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-05 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
Nucleostemin (GNL3) Human Gene Knockout Kit (CRISPR)
KN200066BN 1 Kit

Nucleostemin (GNL3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAP3K15 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
CF808730 100 µg

MAP3K15 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI4C12]
CF811789 100 µg

CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI4C12]

Sign In for Pricing
View Details