Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Qsox2 Rabbit Polyclonal Antibody (HRP)

Qsox2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BC030934, Qscn6l1, SOXN

UniProt

Q3TMX7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Qsox2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_705787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPLL (HNRNPLL) Human Over-expression Lysate
orb1340517 100 µg

HNRPLL (HNRNPLL) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant human NMNAT-1 protein
ATGP3194-020 20 µg

Recombinant human NMNAT-1 protein

Sign In for Pricing
View Details
Pon1 Rabbit Polyclonal Antibody
TA362956 100 µL

Pon1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCK Rabbit Polyclonal Antibody
orb402255 100 µg

DCK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FRMPD3, ID (FERM and PDZ Domain-containing Protein 3, KIAA1817) discontinued
F6076-30 50 µg

FRMPD3, ID (FERM and PDZ Domain-containing Protein 3, KIAA1817) discontinued

Sign In for Pricing
View Details
Anti-SPINK9 Antibody Cy3 Conjugated
A13389-1-Cy3 100 µg/Vial

Anti-SPINK9 Antibody Cy3 Conjugated

Sign In for Pricing
View Details