Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Qsox2 Rabbit Polyclonal Antibody (HRP)

Qsox2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BC030934, Qscn6l1, SOXN

UniProt

Q3TMX7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Qsox2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_705787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD105 Mouse mAb, APC-Cy5.5 conjugated
orb2874455 100 µL

CD105 Mouse mAb, APC-Cy5.5 conjugated

Sign In for Pricing
View Details
3200002M19Rik AAV siRNA Pooled Vector
10542164 1.0 µg

3200002M19Rik AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CRYGD (NM_006891) Human Untagged Clone
SC303845 10 µg

CRYGD (NM_006891) Human Untagged Clone

Sign In for Pricing
View Details
GPR133 Protein Vector (Human) (pPM-C-HA)
PV052743 500 ng

GPR133 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium mshA Protein (aa 1-424)
VAng-Yyj2664-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Avium mshA Protein (aa 1-424)

Sign In for Pricing
View Details
Lentiviral human TRIB1 shRNA (UAS) - Lentiviral human TRIB1 shRNA (UAS) plasmid
GTR15103423 1 Vial

Lentiviral human TRIB1 shRNA (UAS) - Lentiviral human TRIB1 shRNA (UAS) plasmid

Sign In for Pricing
View Details