Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB19 Rabbit Polyclonal Antibody (Biotin)

RAB19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RAB19B

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB19

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDTAGQERFRTITQSYYRS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008749

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFHR2 Polyclonal Antibody, FITC Conjugated
A58540-100 100 µL

CFHR2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
DUSP6 Rabbit mAb
C05991-01 20 µL

DUSP6 Rabbit mAb

Sign In for Pricing
View Details
DUSP6 Rabbit mAb
C05991-02 100 µL

DUSP6 Rabbit mAb

Sign In for Pricing
View Details
DUSP6 Rabbit mAb
C05991-03 2x 100 μL

DUSP6 Rabbit mAb

Sign In for Pricing
View Details
Lcp1 3'UTR Luciferase Stable Cell Line
TU206988 1.0 mL

Lcp1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
1-Methylindol-4-boronic acid pinacol ester
284440-01 100 mg

1-Methylindol-4-boronic acid pinacol ester

Sign In for Pricing
View Details