Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB19 Rabbit Polyclonal Antibody (HRP)

RAB19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAB19B

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDTAGQERFRTITQSYYRS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008749

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM9A siRNA (Human)
MBS827478-01 15 nmol

FAM9A siRNA (Human)

Sign In for Pricing
View Details
FAM9A siRNA (Human)
MBS827478-02 30 nmol

FAM9A siRNA (Human)

Sign In for Pricing
View Details
FAM9A siRNA (Human)
MBS827478-03 5x 30 nmol

FAM9A siRNA (Human)

Sign In for Pricing
View Details
Trmt5 (NM_001108713) Rat Tagged Lenti ORF Clone
RR207226L4 10 µg

Trmt5 (NM_001108713) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HLA-DRB3 Protein Vector (Human) (pPB-C-His)
PV019877 500 ng

HLA-DRB3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ADCK2 Antibody
E51A02450 100 µL

ADCK2 Antibody

Sign In for Pricing
View Details