Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL18A Rabbit Polyclonal Antibody (HRP)

RPL18A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L18A

UniProt

Q02543

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000971

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Activating Molecule In BECN1-Regulated Autophagy Protein 1 (AMBRA1) Antibody (PerCP)
abx447603 100 µg

Activating Molecule In BECN1-Regulated Autophagy Protein 1 (AMBRA1) Antibody (PerCP)

Sign In for Pricing
View Details
AIR12 Antibody
orb784267 2 mg

AIR12 Antibody

Sign In for Pricing
View Details
Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit
MBS3807980-01 48 Well

Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit

Sign In for Pricing
View Details
Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit
MBS3807980-02 96 Well

Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit

Sign In for Pricing
View Details
Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit
MBS3807980-03 5x 96 Well

Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit

Sign In for Pricing
View Details
Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit
MBS3807980-04 10x 96 Well

Rat Luteinizing Hormone-Releasing Hormone (LHRH) ELISA Kit

Sign In for Pricing
View Details