Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm13194 Rabbit Polyclonal Antibody (Biotin)

Gm13194 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OTTMUSG00000010821

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Gm13194

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSLYAQRKRRYDRKRSGYGGQTKPIFCKKAKTTKKIVLTLECVEPNCRSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

XP_355309

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCLAF1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62880R-BF750-01 20 µL

BCLAF1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
BCLAF1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62880R-BF750-02 100 µL

BCLAF1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PTPRR Antibody
MBS9611464-01 0.1 mL

PTPRR Antibody

Sign In for Pricing
View Details
PTPRR Antibody
MBS9611464-02 0.2 mL

PTPRR Antibody

Sign In for Pricing
View Details
PTPRR Antibody
MBS9611464-03 5x 0.2 mL

PTPRR Antibody

Sign In for Pricing
View Details
SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE)
MBS6184608-01 0.1 mL

SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE)

Sign In for Pricing
View Details