Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cplane2 Rabbit Polyclonal Antibody (FITC)

Cplane2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rs, Rsg1, Gm723, b2b2804C, b2b2827C, b2b2804Clo, b2b2827Clo, 6330545A04Rik

UniProt

A2A825

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074643

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti Human Immunodeficiency Virus 1 P24 Monoclonal Antibody
DMABT-51376MH 0.1 mg

Mouse Anti Human Immunodeficiency Virus 1 P24 Monoclonal Antibody

Sign In for Pricing
View Details
FANCF Adenovirus (Human)
20234051 1.0 mL

FANCF Adenovirus (Human)

Sign In for Pricing
View Details
Brsk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4570806 1.0 µg DNA

Brsk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human Fc gamma RIII/CD16 MAb (Clone 1001049)
MAB4325-100 100 µg

Human Fc gamma RIII/CD16 MAb (Clone 1001049)

Sign In for Pricing
View Details
Human CD18/ITGB2 Antibody , FITC
E55A07089 50 Tests

Human CD18/ITGB2 Antibody , FITC

Sign In for Pricing
View Details
Rabbit Polyclonal SPRYD3 Antibody [Alexa Fluor 647]
NBP1-77116AF647 0.1 mL

Rabbit Polyclonal SPRYD3 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details