Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cplane2 Rabbit Polyclonal Antibody (HRP)

Cplane2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rs, Rsg1, Gm723, b2b2804C, b2b2827C, b2b2804Clo, b2b2827Clo, 6330545A04Rik

UniProt

A2A825

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 6330545A04Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074643

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX6 (PAX6/498), CF647 conjugate, 0.1mg/mL
BNC470498-100 1x 100 µL

PAX6 (PAX6/498), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp2 Antibody
A69368-100UG 100 µg

Gp2 Antibody

Sign In for Pricing
View Details
SUMF1 (NM_001164674) Human Tagged ORF Clone
RC228279 10 µg

SUMF1 (NM_001164674) Human Tagged ORF Clone

Sign In for Pricing
View Details
GRIF-1 CRISPR/Cas9 KO Plasmid (h)
sc-413096 20 µg

GRIF-1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal OR10C1 Antibody [DyLight 650]
NBP3-06509C 0.1 mL

Rabbit Polyclonal OR10C1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) KIN13A Polyclonal Antibody
MBS7146404 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) KIN13A Polyclonal Antibody

Sign In for Pricing
View Details