Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH9 Rabbit Polyclonal Antibody (Biotin)

RSPH9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CILD12, C6orf206, MRPS18AL1

UniProt

Q9H1X1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RSPH9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001180270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5A Mouse mAb
C05945-100uL 100 µL

ATP5A Mouse mAb

Sign In for Pricing
View Details
Interleukin 11 Receptor, alpha (IL11Ra, Interleukin-11 Receptor Subunit alpha, IL-11 Receptor Subunit alpha, IL-11R Subunit alpha, IL-11R-alpha, IL-11RA) (MaxLight 405) discontinued
I8433-75A-ML405 100 µL

Interleukin 11 Receptor, alpha (IL11Ra, Interleukin-11 Receptor Subunit alpha, IL-11 Receptor Subunit alpha, IL-11R Subunit alpha, IL-11R-alpha, IL-11RA) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LOC680045 ORF Vector (Rat) (pORF)
ORF069767 1.0 µg DNA

LOC680045 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Anti-AFM Antibody Picoband®, Carrier-free
A00275-2-carrier-free 100 µg/Vial

Anti-AFM Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 6P1 (OR6P1)
MBS7025076-01 0.02 mg

Recombinant Human Olfactory receptor 6P1 (OR6P1)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 6P1 (OR6P1)
MBS7025076-02 0.1 mg

Recombinant Human Olfactory receptor 6P1 (OR6P1)

Sign In for Pricing
View Details