Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3D19 Rabbit Polyclonal Antibody (Biotin)

SH3D19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EBP, EVE1, Kryn, Eve-1, SH3P19

UniProt

C9JDW6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3D19

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001009555

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N⁶- Benzoyladenosine- 3', 5'- cyclic monophosphate (6-Bnz-cAMP), sodium salt
B 009-10 10 µmol ~ 4.6 mg

N⁶- Benzoyladenosine- 3', 5'- cyclic monophosphate (6-Bnz-cAMP), sodium salt

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0352 protein yejL (yejL)
MBS1407913-01 0.02 mg (E-Coli)

Recombinant Escherichia coli UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0352 protein yejL (yejL)
MBS1407913-02 0.1 mg (E-Coli)

Recombinant Escherichia coli UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0352 protein yejL (yejL)
MBS1407913-03 0.02 mg (Yeast)

Recombinant Escherichia coli UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0352 protein yejL (yejL)
MBS1407913-04 0.1 mg (Yeast)

Recombinant Escherichia coli UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0352 protein yejL (yejL)
MBS1407913-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli UPF0352 protein yejL (yejL)

Sign In for Pricing
View Details