Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3D19 Rabbit Polyclonal Antibody (FITC)

SH3D19 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EBP, EVE1, Kryn, Eve-1, SH3P19

UniProt

Q5HYK7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3D19

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Gastric Inhibitory Polypeptide (GIP) ELISA Kit
JL22903-01 48 Tests

Rat Gastric Inhibitory Polypeptide (GIP) ELISA Kit

Sign In for Pricing
View Details
Rat Gastric Inhibitory Polypeptide (GIP) ELISA Kit
JL22903-02 96 Tests

Rat Gastric Inhibitory Polypeptide (GIP) ELISA Kit

Sign In for Pricing
View Details
AFViolet 450 Anti-Human CD32 Antibody
RD30201F-01 20 Tests

AFViolet 450 Anti-Human CD32 Antibody

Sign In for Pricing
View Details
AFViolet 450 Anti-Human CD32 Antibody
RD30201F-02 100 Tests

AFViolet 450 Anti-Human CD32 Antibody

Sign In for Pricing
View Details
AFViolet 450 Anti-Human CD32 Antibody
RD30201F-03 2x 100 Tests

AFViolet 450 Anti-Human CD32 Antibody

Sign In for Pricing
View Details
HIP1R (Huntingtin Interacting Protein 1 Related, HIP12)
H7959-88 100 µg

HIP1R (Huntingtin Interacting Protein 1 Related, HIP12)

Sign In for Pricing
View Details