Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx30 Rabbit Polyclonal Antibody (HRP)

Snx30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

4732481H14Rik, C030041J06Rik

UniProt

Q8CE50

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Snx30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSACIGNCSTALEELTDDITEEFLPVLREYVLYSDSMKGVLKKRDQVQAE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NSUN6 Antibody Picoband® Cy3 Conjugated
A13404-3-Cy3 100 µg/Vial

Anti-NSUN6 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Heme oxygenase 1 Antibody
E300106 100 µg - 200 µL

Heme oxygenase 1 Antibody

Sign In for Pricing
View Details
Anti-Nipah virus/NiV Fusion glycoprotein Nanobody (DS90)
VK521053-01 50 µg

Anti-Nipah virus/NiV Fusion glycoprotein Nanobody (DS90)

Sign In for Pricing
View Details
Anti-Nipah virus/NiV Fusion glycoprotein Nanobody (DS90)
VK521053-02 100 µg

Anti-Nipah virus/NiV Fusion glycoprotein Nanobody (DS90)

Sign In for Pricing
View Details
Anti-Nipah virus/NiV Fusion glycoprotein Nanobody (DS90)
VK521053-03 1 mg

Anti-Nipah virus/NiV Fusion glycoprotein Nanobody (DS90)

Sign In for Pricing
View Details
Deoxyribonucleic Acid, Lambda, BstE II Fragments
B2018314 50 µg

Deoxyribonucleic Acid, Lambda, BstE II Fragments

Sign In for Pricing
View Details