Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snx30 Rabbit Polyclonal Antibody (HRP)

Snx30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

4732481H14Rik, C030041J06Rik

UniProt

Q8CE50

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Snx30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSACIGNCSTALEELTDDITEEFLPVLREYVLYSDSMKGVLKKRDQVQAE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lbp shRNA (UAS) - Lentiviral mouse Lbp shRNA (UAS, iRFP) plasmid
GTR15235816 1 Vial

Lentiviral mouse Lbp shRNA (UAS) - Lentiviral mouse Lbp shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Abcg5 (NM_053754) Rat Untagged Clone
RN201020 10 µg

Abcg5 (NM_053754) Rat Untagged Clone

Sign In for Pricing
View Details
SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (FITC)
MBS6149996-01 0.1 mL

SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (FITC)

Sign In for Pricing
View Details
SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (FITC)
MBS6149996-02 5x 0.1 mL

SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (FITC)

Sign In for Pricing
View Details
P63 Polyclonal Antibody
BT-AP06846-01 20 µL

P63 Polyclonal Antibody

Sign In for Pricing
View Details
P63 Polyclonal Antibody
BT-AP06846-02 50 µL

P63 Polyclonal Antibody

Sign In for Pricing
View Details