Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK35 Rabbit Polyclonal Antibody (Biotin)

STK35 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CLIK1, STK35L1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human STK35

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LENPKMELHIPQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_543026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (MaxLight 550)
N2835-01D-ML550 100 µL

NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (MaxLight 550)

Sign In for Pricing
View Details
Ginkgetin
BA2762-5 5 mg

Ginkgetin

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)
MBS2110465-01 0.1 mL

APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)
MBS2110465-02 0.2 mL

APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)
MBS2110465-03 0.5 mL

APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)

Sign In for Pricing
View Details
APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)
MBS2110465-04 1 mL

APC/Cy7 Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)

Sign In for Pricing
View Details