EPS15, Human (His)
EPS15 is a multifunctional protein that regulates cell growth, controls mitotic signaling, and contributes to receptor tyrosine kinase (RTK) internalization, particularly affecting EGFR. As a clathrin adapter, EPS15 is critical for the assembly and maturation of clathrin-coated pits (CCP), affecting the endocytosis of molecules such as ITGB1 and transferrin receptor (TFR) . EPS15 Protein, Human (His) is the recombinant human-derived EPS15 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
EPS15 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/eps15-protein-human-his.html
Smiles
CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Molecular Formula
2060 (Gene_ID) P42566-1 (C657-D798) (Accession)
Molecular Weight
20.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items