Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR6 Rabbit Polyclonal Antibody (Biotin)

ACTR6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARP6, CDA12, hARP6, hARPX, HSPC281, MSTP136

UniProt

Q9GZN1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACTR6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071941

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo32 Mouse Pre-designed siRNA Set A
HY-RS20156 1 Set

Fbxo32 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS9377085-01 48 Well

Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS9377085-02 96 Well

Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS9377085-03 5x 96 Well

Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit
MBS9377085-04 10x 96 Well

Monkey Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Human Matrix MetalloProteinase 19 (MMP-19) ELISA Kit
JL12691-01 48 Tests

Human Matrix MetalloProteinase 19 (MMP-19) ELISA Kit

Sign In for Pricing
View Details