Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH16A1 Rabbit Polyclonal Antibody (HRP)

ALDH16A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IZ83

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDH16A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ribonuclease A8 (RNASE8) ELISA Kit
RD-RNASE8-Hu-01 96 Tests

Human Ribonuclease A8 (RNASE8) ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A8 (RNASE8) ELISA Kit
RD-RNASE8-Hu-02 48 Tests

Human Ribonuclease A8 (RNASE8) ELISA Kit

Sign In for Pricing
View Details
RANK (TNFRSF11A) Rabbit Polyclonal Antibody
TA360960 100 µL

RANK (TNFRSF11A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD4 Recombinant Chimeric Antibody Antibody
HA601557 100 µL

CD4 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL
BNC042497-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bulk Human IgG3 (IB3) Isotype Control
ICH2256-50mg 50 mg

Bulk Human IgG3 (IB3) Isotype Control

Sign In for Pricing
View Details