Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP27 Rabbit Polyclonal Antibody (HRP)

ARHGAP27 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP905, SH3D20, SH3P20, CAMGAP1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHGAP27

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_954976

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OX2R Polyclonal Antibody
E-AB-11049-01 20 µL

OX2R Polyclonal Antibody

Sign In for Pricing
View Details
OX2R Polyclonal Antibody
E-AB-11049-02 60 µL

OX2R Polyclonal Antibody

Sign In for Pricing
View Details
OX2R Polyclonal Antibody
E-AB-11049-03 120 µL

OX2R Polyclonal Antibody

Sign In for Pricing
View Details
OX2R Polyclonal Antibody
E-AB-11049-04 200 µL

OX2R Polyclonal Antibody

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (SK3), CF®514 Conjugate - Biotium Choice
P001-514-500 1x 500 µL

CD4 Mouse Monoclonal Antibody (SK3), CF®514 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Nlrp12 Mouse Gene Knockout Kit (CRISPR)
KN311043LP 1 Kit

Nlrp12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details