Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL6IP4 Rabbit Polyclonal Antibody (FITC)

ARL6IP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SR-25, SRp25, SFRS20, SRrp37

UniProt

Q66PJ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARL6IP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSSSSSDGRKKRGKYKDKRRKKKKKRKKLKKKGKEKAEAQQVEALPGPSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002251.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)
KN209258RB 1 Kit

Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Svopl Mouse Gene Knockout Kit (CRISPR)
KN517020 1 Kit

Svopl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Parotid gland
CS700072 5x 5 µm

Tissue FFPE Sections, Parotid gland

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF568 conjugate, 0.1mg/mL
BNC681990-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (KRT10/1990R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details