Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL6IP4 Rabbit Polyclonal Antibody (HRP)

ARL6IP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SR-25, SRp25, SFRS20, SRrp37

UniProt

Q66PJ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARL6IP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSSSSSDGRKKRGKYKDKRRKKKKKRKKLKKKGKEKAEAQQVEALPGPSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002251.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM-3 (Tim3, Timd3, T-cell Immunoglobulin Mucin 3, Havcr2) (PE) discontinued
215174 100 Tests

TIM-3 (Tim3, Timd3, T-cell Immunoglobulin Mucin 3, Havcr2) (PE) discontinued

Sign In for Pricing
View Details
Tgfbr2, CT (Tgfbr2, TGF-beta receptor type-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II) (Biotin) discontinued
042781-Biotin 200 µL

Tgfbr2, CT (Tgfbr2, TGF-beta receptor type-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Bcl-6 Antibody (rBCL6/1475) [Alexa Fluor 405]
NBP3-08835AF405 100 µL

Mouse Monoclonal Bcl-6 Antibody (rBCL6/1475) [Alexa Fluor 405]

Sign In for Pricing
View Details
Act1 (D-11) PE
sc-398161 PE 200 µg/mL

Act1 (D-11) PE

Sign In for Pricing
View Details
RCV1 (Recoverin, RCV1) (MaxLight 490)
MBS6208261-01 0.1 mL

RCV1 (Recoverin, RCV1) (MaxLight 490)

Sign In for Pricing
View Details
RCV1 (Recoverin, RCV1) (MaxLight 490)
MBS6208261-02 5x 0.1 mL

RCV1 (Recoverin, RCV1) (MaxLight 490)

Sign In for Pricing
View Details