Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN2A2 Rabbit Polyclonal Antibody (Biotin)

BTN2A2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BTF2, BT2.2, BTN2.2

UniProt

Q8WVV5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BTN2A2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_008926

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit
MBS7221914-01 48 Well

Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit
MBS7221914-02 96 Well

Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit
MBS7221914-03 5x 96 Well

Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit
MBS7221914-04 10x 96 Well

Goat Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 (CHCHD6) ELISA Kit

Sign In for Pricing
View Details
SLC38A5 Rabbit Polyclonal Antibody (Biotin)
orb452639 100 µL

SLC38A5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rat Zfp318 Pre-designed siRNA Set A
SI216314A 1 Each

Rat Zfp318 Pre-designed siRNA Set A

Sign In for Pricing
View Details