Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1 Rabbit Polyclonal Antibody (FITC)

BTN3A1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BTF5, BT3.1, CD277, BTN3.1

UniProt

O00481

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTN3A1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin 1 Blocking Peptide
CBP1955-01 1 mg

Trypsin 1 Blocking Peptide

Sign In for Pricing
View Details
Trypsin 1 Blocking Peptide
CBP1955-02 5 mg

Trypsin 1 Blocking Peptide

Sign In for Pricing
View Details
Cleaved-MMP-23 (Y79) Polyclonal Antibody
RA23514-01 50 µL

Cleaved-MMP-23 (Y79) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-MMP-23 (Y79) Polyclonal Antibody
RA23514-02 100 µL

Cleaved-MMP-23 (Y79) Polyclonal Antibody

Sign In for Pricing
View Details
KCNE4 (Potassium Voltage-gated Channel Subfamily E Member 4, MinK-related Peptide 3, Minimum Potassium Ion Channel-related Peptide 3, Potassium Channel Subunit beta MiRP3, MGC20353) (MaxLight 650)
128738-ML650 100 µL

KCNE4 (Potassium Voltage-gated Channel Subfamily E Member 4, MinK-related Peptide 3, Minimum Potassium Ion Channel-related Peptide 3, Potassium Channel Subunit beta MiRP3, MGC20353) (MaxLight 650)

Sign In for Pricing
View Details
CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (MaxLight 750) discontinued
143659-ML750 100 µL

CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (MaxLight 750) discontinued

Sign In for Pricing
View Details