Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf49 Rabbit Polyclonal Antibody (HRP)

C1orf49 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TSC24, C1orf49

UniProt

Q5T0J7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1orf49

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115502

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2E3 (PNR, RNR, Photoreceptor-specific Nuclear Receptor, Nuclear Receptor Subfamily 2 Group E Member 3, Retina-specific Nuclear Receptor) (MaxLight 490)
MBS6387464-01 0.1 mL

NR2E3 (PNR, RNR, Photoreceptor-specific Nuclear Receptor, Nuclear Receptor Subfamily 2 Group E Member 3, Retina-specific Nuclear Receptor) (MaxLight 490)

Sign In for Pricing
View Details
NR2E3 (PNR, RNR, Photoreceptor-specific Nuclear Receptor, Nuclear Receptor Subfamily 2 Group E Member 3, Retina-specific Nuclear Receptor) (MaxLight 490)
MBS6387464-02 5x 0.1 mL

NR2E3 (PNR, RNR, Photoreceptor-specific Nuclear Receptor, Nuclear Receptor Subfamily 2 Group E Member 3, Retina-specific Nuclear Receptor) (MaxLight 490)

Sign In for Pricing
View Details
Human 3-oxoacid CoA transferase 2 ELISA Kit
GTR10461634 96 Well

Human 3-oxoacid CoA transferase 2 ELISA Kit

Sign In for Pricing
View Details
C1orf122 antibody - N-terminal region
MBS3211324-01 0.1 mL

C1orf122 antibody - N-terminal region

Sign In for Pricing
View Details
C1orf122 antibody - N-terminal region
MBS3211324-02 5x 0.1 mL

C1orf122 antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal HLA DRA Antibody (169-1B5.2) [Biotin]
NBP2-47722B 0.1 mL

Mouse Monoclonal HLA DRA Antibody (169-1B5.2) [Biotin]

Sign In for Pricing
View Details