Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tex35 Rabbit Polyclonal Antibody (HRP)

Tex35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TSC24, C1orf49

UniProt

Q5T0J7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human Tex35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR21 Protein Vector (Rat) (pPB-C-His)
PV271194 500 ng

GPR21 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ATM Antibody Blocking Peptide
orb72364 500 µg

ATM Antibody Blocking Peptide

Sign In for Pricing
View Details
Mouse Yjefn3 Pre-designed siRNA Set B
SI116183B 1 Each

Mouse Yjefn3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Goat Mannose Receptor (MR) ELISA Kit
MBS265094-01 48 Well

Goat Mannose Receptor (MR) ELISA Kit

Sign In for Pricing
View Details
Goat Mannose Receptor (MR) ELISA Kit
MBS265094-02 96 Well

Goat Mannose Receptor (MR) ELISA Kit

Sign In for Pricing
View Details
Goat Mannose Receptor (MR) ELISA Kit
MBS265094-03 5x 96 Well

Goat Mannose Receptor (MR) ELISA Kit

Sign In for Pricing
View Details