Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf2 Rabbit Polyclonal Antibody (HRP)

C11orf2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FFR, ANG2, ANG3, PCH13, C11orf2, C11orf3

UniProt

Q9UID3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C11orf2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSYTPSAPMDTNLLSNIQKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037397

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHOX_ALCSP Goat Polyclonal Antibody
TA396661S 25 µL

CHOX_ALCSP Goat Polyclonal Antibody

Sign In for Pricing
View Details
PTPRN Human Gene Knockout Kit (CRISPR)
KN420230 1 Kit

PTPRN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Anti-SARS-CoV-2 Spike RBD antibody (ABMX-003)
10-2006-100 100 µg

Recombinant Anti-SARS-CoV-2 Spike RBD antibody (ABMX-003)

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_001135702) Human Recombinant Protein
TP327049L 1 mg

14-3-3 zeta (YWHAZ) (NM_001135702) Human Recombinant Protein

Sign In for Pricing
View Details
Hsp40 (DNAJB1) Rabbit Polyclonal Antibody
AP22890PU-N 50 µg

Hsp40 (DNAJB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Coelenterazine CP
#10112-1 1x 1 mg

Coelenterazine CP

Sign In for Pricing
View Details