Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC59 Rabbit Polyclonal Antibody (FITC)

CCDC59 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BR22, TAP26, HSPC128

UniProt

Q9P031

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC59

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DQ) (SPV-L3), CF488A conjugate, 0.1mg/mL
BNC880200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF488A conjugate, 0.1mg/mL
BNC880725-500 1x 500 µL

DOG-1 (DOG1.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF740 conjugate, 0.1mg/mL
BNC742302-100 1x 100 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3528), CF568 conjugate, 0.1mg/mL
BNC683528-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3528), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse EDAR/DL Protein (Fc Tag)
PKSM041006-01 10 µg

Recombinant Mouse EDAR/DL Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse EDAR/DL Protein (Fc Tag)
PKSM041006-02 50 µg

Recombinant Mouse EDAR/DL Protein (Fc Tag)

Sign In for Pricing
View Details