Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC59 Rabbit Polyclonal Antibody (HRP)

CCDC59 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BR22, TAP26, HSPC128

UniProt

Q9P031

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC59

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ERN1 Polyclonal Antibody
HF537014-01 50 µg

Anti-ERN1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ERN1 Polyclonal Antibody
HF537014-02 100 µg

Anti-ERN1 Polyclonal Antibody

Sign In for Pricing
View Details
Kallikrein 6, ID (KLK6, PRSS18, PRSS9, Kallikrein-6, Neurosin, Protease M, SP59, Serine protease 18, Serine protease 9, Zyme) (MaxLight 490) discontinued
037262-ML490 100 µL

Kallikrein 6, ID (KLK6, PRSS18, PRSS9, Kallikrein-6, Neurosin, Protease M, SP59, Serine protease 18, Serine protease 9, Zyme) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TPST1 Rabbit Polyclonal Antibody (Cy5)
orb885049 100 µL

TPST1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
3-Amino-5- (aminosulfonyl) -4-phenoxy-benzoic Acid Methyl Ester
001928 10 mg

3-Amino-5- (aminosulfonyl) -4-phenoxy-benzoic Acid Methyl Ester

Sign In for Pricing
View Details
FCGR1A Rabbit Polyclonal Antibody
orb402274 100 µg

FCGR1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details