Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC99 Rabbit Polyclonal Antibody (Biotin)

CCDC99 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCDC99

UniProt

Q96EA4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC99

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BUB1 (Mitotic Checkpoint Serine/Threonine-protein Kinase BUB1, hBub1, BUB1A, BUB1L)
124051 100 µg

BUB1 (Mitotic Checkpoint Serine/Threonine-protein Kinase BUB1, hBub1, BUB1A, BUB1L)

Sign In for Pricing
View Details
His tag Recombinant Rabbit mAb, RBITC conjugated
orb3125576 100 µL

His tag Recombinant Rabbit mAb, RBITC conjugated

Sign In for Pricing
View Details
Ubiquilin 4 (Ubiquilin-4, Ataxin-1 interacting Ubiquitin-like Protein, A1Up, Ataxin-1 Ubiquitin-like-interacting Protein A1U, Connexin43-interacting Protein of 75kD, CIP75, UBQLN4, C1orf6, CIP75, UBIN) (MaxLight 490)
MBS6460062-01 0.1 mL

Ubiquilin 4 (Ubiquilin-4, Ataxin-1 interacting Ubiquitin-like Protein, A1Up, Ataxin-1 Ubiquitin-like-interacting Protein A1U, Connexin43-interacting Protein of 75kD, CIP75, UBQLN4, C1orf6, CIP75, UBIN) (MaxLight 490)

Sign In for Pricing
View Details
Ubiquilin 4 (Ubiquilin-4, Ataxin-1 interacting Ubiquitin-like Protein, A1Up, Ataxin-1 Ubiquitin-like-interacting Protein A1U, Connexin43-interacting Protein of 75kD, CIP75, UBQLN4, C1orf6, CIP75, UBIN) (MaxLight 490)
MBS6460062-02 5x 0.1 mL

Ubiquilin 4 (Ubiquilin-4, Ataxin-1 interacting Ubiquitin-like Protein, A1Up, Ataxin-1 Ubiquitin-like-interacting Protein A1U, Connexin43-interacting Protein of 75kD, CIP75, UBQLN4, C1orf6, CIP75, UBIN) (MaxLight 490)

Sign In for Pricing
View Details
Elx-02 disulfate
UPD62233-01 5 mg

Elx-02 disulfate

Sign In for Pricing
View Details
Elx-02 disulfate
UPD62233-02 10 mg

Elx-02 disulfate

Sign In for Pricing
View Details