Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC99 Rabbit Polyclonal Antibody (FITC)

CCDC99 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CCDC99

UniProt

Q96EA4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC99

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit
MBS7616586-01 48 Well

Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit

Sign In for Pricing
View Details
Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit
MBS7616586-02 96 Well

Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit

Sign In for Pricing
View Details
Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit
MBS7616586-03 5x 96 Well

Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit

Sign In for Pricing
View Details
Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit
MBS7616586-04 10x 96 Well

Human HGV-IgG (hepatitis g virus antibody IgG) ELISA Kit

Sign In for Pricing
View Details
SP140 Protein Vector (Mouse) (pPM-C-HA)
PV232856 500 ng

SP140 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2,KCNN2  ELISA KIT
JOT-EK0835Ra-01 48 Well

Rat Potassium Intermediate Small Conductance Calcium Activated Channel Subfamily N, Member 2,KCNN2 ELISA KIT

Sign In for Pricing
View Details