Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC42SE2 Rabbit Polyclonal Antibody (FITC)

CDC42SE2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPEC2

UniProt

Q9NRR3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CDC42SE2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064625

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ghrelin 28 (n-octanoyl Ser26) Rabbit Polyclonal Antibody (APC)
orb996659 100 µL

Ghrelin 28 (n-octanoyl Ser26) Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued
223502-01 50 µL

Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued

Sign In for Pricing
View Details
Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued
223502-02 100 µL

Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A11 ELISA Kit
MBS033855-01 48 Well

Human S100 Calcium Binding Protein A11 ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A11 ELISA Kit
MBS033855-02 96 Well

Human S100 Calcium Binding Protein A11 ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A11 ELISA Kit
MBS033855-03 5x 96 Well

Human S100 Calcium Binding Protein A11 ELISA Kit

Sign In for Pricing
View Details