Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKL1 Rabbit Polyclonal Antibody (HRP)

CDKL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P42, KKIALRE

UniProt

J3KMW1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human CDKL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALRE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001269165.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP3B2, NT (AP3B2, AP-3 complex subunit beta-2, Adapter-related protein complex 3 subunit beta-2, Adaptor protein complex AP-3 subunit beta-2, Beta-3B-adaptin, Clathrin assembly protein complex 3 beta-2 large chain, Neuron-specific vesicle coat protein beta-NAP) (PE) discontinued
031946-PE 200 µL

AP3B2, NT (AP3B2, AP-3 complex subunit beta-2, Adapter-related protein complex 3 subunit beta-2, Adaptor protein complex AP-3 subunit beta-2, Beta-3B-adaptin, Clathrin assembly protein complex 3 beta-2 large chain, Neuron-specific vesicle coat protein beta-NAP) (PE) discontinued

Sign In for Pricing
View Details
SPBC24C6.09c Antibody
orb855339 2 mg

SPBC24C6.09c Antibody

Sign In for Pricing
View Details
Anti-Galectin 10/CLC Antibody Picoband® Fluoro594 Conjugated
A01350-Fluoro594 100 µg/Vial

Anti-Galectin 10/CLC Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
SLC43A3 Human Over-expression Lysate
orb1375578 20 µg

SLC43A3 Human Over-expression Lysate

Sign In for Pricing
View Details
SPAG4L/SRG4 Rabbit Polyclonal Antibody (BF488)
orb2536671 100 µL

SPAG4L/SRG4 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Human Ataxin-1-like, ATXN1L ELISA Kit
MBS9328223-01 48 Well

Human Ataxin-1-like, ATXN1L ELISA Kit

Sign In for Pricing
View Details