Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKMT1A Rabbit Polyclonal Antibody (Biotin)

CKMT1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CKMT1, U-MtCK, mia-CK

UniProt

P12532

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CKMT1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001015001

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcospan siRNA (h)
sc-43426 10 µM

Sarcospan siRNA (h)

Sign In for Pricing
View Details
TIP120B (CAND2) (NM_001162499) Human Over-expression Lysate
LH00904V 100 µg

TIP120B (CAND2) (NM_001162499) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Jagged 1 Active Recombinant Protein C-His Tag Lyophilized
MBS8432571 Inquire

Human Jagged 1 Active Recombinant Protein C-His Tag Lyophilized

Sign In for Pricing
View Details
GFR alpha 2 (GDNF family receptor alpha-2, GFR-alpha-2, Neurturin receptor alpha, NTNR-alpha, NRTNR-alpha, TGF-beta-related neurotrophic factor receptor 2, GDNF receptor beta, GDNFR-beta, RET ligand 2) (Not for Export EU)
G2033-31 100 µL

GFR alpha 2 (GDNF family receptor alpha-2, GFR-alpha-2, Neurturin receptor alpha, NTNR-alpha, NRTNR-alpha, TGF-beta-related neurotrophic factor receptor 2, GDNF receptor beta, GDNFR-beta, RET ligand 2) (Not for Export EU)

Sign In for Pricing
View Details
SGK071, CT (SGK071, C9orf96, Protein kinase-like protein SgK071, Sugen kinase 071)
MBS6002372-01 0.2 mL

SGK071, CT (SGK071, C9orf96, Protein kinase-like protein SgK071, Sugen kinase 071)

Sign In for Pricing
View Details
SGK071, CT (SGK071, C9orf96, Protein kinase-like protein SgK071, Sugen kinase 071)
MBS6002372-02 5x 0.2 mL

SGK071, CT (SGK071, C9orf96, Protein kinase-like protein SgK071, Sugen kinase 071)

Sign In for Pricing
View Details