Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dapl1 Rabbit Polyclonal Antibody (HRP)

Dapl1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EED, EEDA, 2310032F03Rik

UniProt

Q9D757

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dapl1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MANEVQVLPSPLKGRYAPAVKAGGMRISKKQEMGVLERHTKKTGLEKTSA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_083999

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (HRP)
130531-HRP 100 µL

NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (HRP)

Sign In for Pricing
View Details
SON shRNA (m) Lentiviral Particles
sc-153684-V 200 µL

SON shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
TK2, NT (Thymidine Kinase 2, Mitochondrial, Mt-TK) (FITC) discontinued
T5151-84-FITC 200 µL

TK2, NT (Thymidine Kinase 2, Mitochondrial, Mt-TK) (FITC) discontinued

Sign In for Pricing
View Details
DOT1L Antibody
orb1331983 100 µg

DOT1L Antibody

Sign In for Pricing
View Details
Peroxiredoxin 1/PAG Rabbit mAb
A4956-01 100 μL

Peroxiredoxin 1/PAG Rabbit mAb

Sign In for Pricing
View Details
Peroxiredoxin 1/PAG Rabbit mAb
A4956-02 20 µL

Peroxiredoxin 1/PAG Rabbit mAb

Sign In for Pricing
View Details