Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCDC5 Rabbit Polyclonal Antibody (Biotin)

DCDC5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KIAA1493

UniProt

Q6ZRR9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human DCDC5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular endothelial growth factor receptor 1
orb1646154-01 50 µg

Vascular endothelial growth factor receptor 1

Sign In for Pricing
View Details
Vascular endothelial growth factor receptor 1
orb1646154-02 100 µg

Vascular endothelial growth factor receptor 1

Sign In for Pricing
View Details
Vascular endothelial growth factor receptor 1
orb1646154-03 1 mg

Vascular endothelial growth factor receptor 1

Sign In for Pricing
View Details
Anti-P2X4/P2RX4 Antibody Picoband®, iFluor647 Conjugate
A04715-2-iFluor647 100 µg

Anti-P2X4/P2RX4 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
CXCL12 Antibody, FITC conjugated
A76732-100UL 100 µL

CXCL12 Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Arf GAP with GTPase, ANK repeat and PH domain containing protein 7 (AGAP7) ELISA Kit
GTR10343802 96 Well

Mouse Arf GAP with GTPase, ANK repeat and PH domain containing protein 7 (AGAP7) ELISA Kit

Sign In for Pricing
View Details