Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCDC5 Rabbit Polyclonal Antibody (HRP)

DCDC5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1493

UniProt

Q6ZRR9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human DCDC5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTTEPYAPVRLRVLQNGEKNKNRSVTILGPDISPGRKTQCTEILNLPSAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCN2 (Neutrophil Gelatinase-associated Lipocalin, NGAL, 25kD alpha-2-microglobulin-related Subunit of MMP-9, Lipocalin-2, Oncogene 24p3, Siderocalin LCN2, p25, HNL, NGAL) discontinued
L2499-17U 100 µg

LCN2 (Neutrophil Gelatinase-associated Lipocalin, NGAL, 25kD alpha-2-microglobulin-related Subunit of MMP-9, Lipocalin-2, Oncogene 24p3, Siderocalin LCN2, p25, HNL, NGAL) discontinued

Sign In for Pricing
View Details
Cadherin like 23 (CDH23) (NM_001171930) Human Tagged Lenti ORF Clone
RC230709L3 10 µg

Cadherin like 23 (CDH23) (NM_001171930) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRNAR10 CRISPRa sgRNA lentivector (set of three targets)(Human)
48332121 3x 1.0µg DNA

TRNAR10 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human anti-P.aeruginosa blaVIM-4 IgG
E4A11A48-BV-G-50 50 µg

Human anti-P.aeruginosa blaVIM-4 IgG

Sign In for Pricing
View Details
Olr1545 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV636851 1.0 µg DNA

Olr1545 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PTPN14, CT (PTPN14, PEZ, Tyrosine-protein phosphatase non-receptor type 14, Protein-tyrosine phosphatase pez) (MaxLight 490)
MBS6338959-01 0.1 mL

PTPN14, CT (PTPN14, PEZ, Tyrosine-protein phosphatase non-receptor type 14, Protein-tyrosine phosphatase pez) (MaxLight 490)

Sign In for Pricing
View Details