Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEF8 Rabbit Polyclonal Antibody (HRP)

DEF8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20186, MGC104349

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DEF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060172

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suvonstobart Biosimilar - Research Grade
PX-TA2384-01 50 µg

Suvonstobart Biosimilar - Research Grade

Sign In for Pricing
View Details
Suvonstobart Biosimilar - Research Grade
PX-TA2384-02 100 µg

Suvonstobart Biosimilar - Research Grade

Sign In for Pricing
View Details
Suvonstobart Biosimilar - Research Grade
PX-TA2384-03 1 mg

Suvonstobart Biosimilar - Research Grade

Sign In for Pricing
View Details
Recombinant Rat FGF-basic Protein
PROTP13109-1 50 µg

Recombinant Rat FGF-basic Protein

Sign In for Pricing
View Details
Recombinant IlvGMEDA operon leader peptide (ilvL)
MBS7093032-01 0.05 mg (E-Coli)

Recombinant IlvGMEDA operon leader peptide (ilvL)

Sign In for Pricing
View Details
Recombinant IlvGMEDA operon leader peptide (ilvL)
MBS7093032-02 0.2 mg (E-Coli)

Recombinant IlvGMEDA operon leader peptide (ilvL)

Sign In for Pricing
View Details