Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEF8 Rabbit Polyclonal Antibody (Biotin)

DEF8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ20186, MGC104349

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DEF8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001229746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim2 (NM_001108552) Rat Tagged Lenti ORF Clone
RR203115L3 10 µg

Trim2 (NM_001108552) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TBC1D3F Antibody (Center)
MBS9207119-01 0.08 mL

TBC1D3F Antibody (Center)

Sign In for Pricing
View Details
TBC1D3F Antibody (Center)
MBS9207119-02 0.4 mL

TBC1D3F Antibody (Center)

Sign In for Pricing
View Details
TBC1D3F Antibody (Center)
MBS9207119-03 5x 0.4 mL

TBC1D3F Antibody (Center)

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (TR1.02) [HRP]
NBP2-80069H 0.1 mL

Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (TR1.02) [HRP]

Sign In for Pricing
View Details
DYRK4 Protein Vector (Mouse) (pPB-N-His)
PV173975 500 ng

DYRK4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details