Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEF8 Rabbit Polyclonal Antibody (Biotin)

DEF8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ20186, MGC104349

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DEF8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PNEDEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCYY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001229746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Proteasome 20S C2 Antibody (1D9-1C7)
H00005682-M01 0.1 mg

Mouse Monoclonal Proteasome 20S C2 Antibody (1D9-1C7)

Sign In for Pricing
View Details
Lentiviral mouse Mapk15 shRNA (UAS) - Lentiviral mouse Mapk15 shRNA (UAS, iRFP) (25)
GTR15269774 1 Vial

Lentiviral mouse Mapk15 shRNA (UAS) - Lentiviral mouse Mapk15 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Tm9sf1 ORF Vector (Rat) (pORF)
46805016 1.0 µg DNA

Tm9sf1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
GPR15 Antibody
E043419 100 µg -100 µL

GPR15 Antibody

Sign In for Pricing
View Details
KIAA1737 ORF Vector (Human) (pORF)
ORF005653 1.0 µg DNA

KIAA1737 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Motilin Polyclonal Antibody
bs-1445R 100 µL

Motilin Polyclonal Antibody

Sign In for Pricing
View Details