Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTPD6 Rabbit Polyclonal Antibody (HRP)

ENTPD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD39L2, IL6ST2, IL-6SAG, NTPDase-6, dJ738P15.3

UniProt

O75354

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ENTPD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001107561.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ltb Pre-designed siRNA Set B
SI107933B 1 Each

Mouse Ltb Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Anti-Goat Heat Shock Protein 70 (HSP70) Monoclonal Antibody
VD8N90 1 Each

Mouse Anti-Goat Heat Shock Protein 70 (HSP70) Monoclonal Antibody

Sign In for Pricing
View Details
KLF7 (NM_003709) Human Tagged ORF Clone
RC215688 10 µg

KLF7 (NM_003709) Human Tagged ORF Clone

Sign In for Pricing
View Details
GSTT2 Polyclonal Antibody, Biotin Conjugated
bs-13441R-Biotin 100 µL

GSTT2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal DAP3 Antibody (42C617.1.2) [Alexa Fluor 350]
NB100-56539AF350 0.1 mL

Mouse Monoclonal DAP3 Antibody (42C617.1.2) [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Filaggrin (FLG)
MBS2009553-01 0.01 mg

Recombinant Filaggrin (FLG)

Sign In for Pricing
View Details