Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM49B Rabbit Polyclonal Antibody (HRP)

FAM49B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L1, CYRI, BM-009, CYRI-B, FAM49B

UniProt

Q9NUQ9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM49B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057707

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Immunoglobulin G4 (IgG4) ELISA Kit
abx350070-01 96 Tests

Human Immunoglobulin G4 (IgG4) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin G4 (IgG4) ELISA Kit
abx350070-02 5x 96 Tests

Human Immunoglobulin G4 (IgG4) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin G4 (IgG4) ELISA Kit
abx350070-03 10x 96 Tests

Human Immunoglobulin G4 (IgG4) ELISA Kit

Sign In for Pricing
View Details
Anti-Cytokeratin 13 Antibody
MBS8309812-01 0.03 mL

Anti-Cytokeratin 13 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 13 Antibody
MBS8309812-02 0.05 mL

Anti-Cytokeratin 13 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 13 Antibody
MBS8309812-03 0.1 mL

Anti-Cytokeratin 13 Antibody

Sign In for Pricing
View Details