Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM50A Rabbit Polyclonal Antibody (HRP)

FAM50A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

9F, XAP5, HXC26, MRXSA, HXC-26, DXS9928E

UniProt

Q14320

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM50A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004690

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slide Drying Cabinet BCBT-303
BCBT-303 1 Unit

Slide Drying Cabinet BCBT-303

Sign In for Pricing
View Details
Human TIMM8B activation kit by CRISPRa
GA108888 1 Kit

Human TIMM8B activation kit by CRISPRa

Sign In for Pricing
View Details
Lass5 (CERS5) Human Gene Knockout Kit (CRISPR)
KN207649RB 1 Kit

Lass5 (CERS5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Anti-GFP Tag Antibody
RC-3067-01 50 μL

Recombinant Anti-GFP Tag Antibody

Sign In for Pricing
View Details
Recombinant Anti-GFP Tag Antibody
RC-3067-02 100 µL

Recombinant Anti-GFP Tag Antibody

Sign In for Pricing
View Details
Recombinant Anti-GFP Tag Antibody
RC-3067-03 1 mL

Recombinant Anti-GFP Tag Antibody

Sign In for Pricing
View Details