Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLGALT2 Rabbit Polyclonal Antibody (HRP)

COLGALT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C1orf17, GLT25D2, ColGalT 2

UniProt

Q8IYK4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human COLGALT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQVKEPEKAVPNV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001290349.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD L2 (PDCD1LG2) (N-term) Rabbit Polyclonal Antibody
AP53228PU-N 400 µL

PD L2 (PDCD1LG2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Wdr41 Mouse Gene Knockout Kit (CRISPR)
KN519358 1 Kit

Wdr41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Terb1 Mouse Gene Knockout Kit (CRISPR)
KN502747 1 Kit

Terb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SERPING1 Rabbit Polyclonal Antibody
HA500008 100 µL

SERPING1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDST1 Human Gene Knockout Kit (CRISPR)
KN221638LP 1 Kit

NDST1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PCBP3 (NM_001130141) Human Over-expression Lysate
LY427177 100 µg

PCBP3 (NM_001130141) Human Over-expression Lysate

Sign In for Pricing
View Details