Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNG4 Rabbit Polyclonal Antibody (Biotin)

GNG4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZp547K1018, FLJ23803, FLJ34187

UniProt

P50150

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human GNG4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004476

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp318 (NM_207671) Mouse Tagged ORF Clone
MG225084 10 µg

Zfp318 (NM_207671) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)
MBS1193298-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)

Sign In for Pricing
View Details
Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)
MBS1193298-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)

Sign In for Pricing
View Details
Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)
MBS1193298-03 0.02 mg (Yeast)

Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)

Sign In for Pricing
View Details
Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)
MBS1193298-04 0.1 mg (Yeast)

Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)

Sign In for Pricing
View Details
Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)
MBS1193298-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Probable rRNA maturation factor YbeY (ybeY)

Sign In for Pricing
View Details