Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRF4 Rabbit Polyclonal Antibody (HRP)

ADGRF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGR18, GPR115

UniProt

Q8IZF3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR115

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQATMICCLVFFLSTECSHYRSKIHLKAGDKLQSPEGKPKTGRIQEKCEG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_722580

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK9 Double Nickase Plasmid (m)
sc-430380-NIC 20 µg

KLK9 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit
MBS7203477-01 48 Well

Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit
MBS7203477-02 96 Well

Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit
MBS7203477-03 5x 96 Well

Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit
MBS7203477-04 10x 96 Well

Rabbit Coiled-coil domain-containing protein 165 (KIAA0802) ELISA Kit

Sign In for Pricing
View Details
FGFR1 antibody
70R-36800 0.1 mg

FGFR1 antibody

Sign In for Pricing
View Details