Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFV Rabbit Polyclonal Antibody (Biotin)

H2AFV Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H2AV, H2AFV, H2A.Z-2

UniProt

A6NKY0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFV

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036544

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COXI, ID (MT-CO1, COI, COXI, MTCO1, Cytochrome c oxidase subunit 1, Cytochrome c oxidase polypeptide I) (FITC) discontinued
034149-FITC 200 µL

COXI, ID (MT-CO1, COI, COXI, MTCO1, Cytochrome c oxidase subunit 1, Cytochrome c oxidase polypeptide I) (FITC) discontinued

Sign In for Pricing
View Details
Narrow Mouth Bottle, LDPE, 60 mL - 72 un. - ABDOS
P11141 72 Units/Pack

Narrow Mouth Bottle, LDPE, 60 mL - 72 un. - ABDOS

Sign In for Pricing
View Details
Recombinant Human IL-9
P1124-.1 100 µg

Recombinant Human IL-9

Sign In for Pricing
View Details
GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6, Polypeptide GalNAc Transferase 6, pp-GaNTase 6, GalNAcT6, GalNAc-T6, N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide) (AP) discontinued
127141-AP 100 µL

GALNT6 (Polypeptide N-acetylgalactosaminyltransferase 6, Polypeptide GalNAc Transferase 6, pp-GaNTase 6, GalNAcT6, GalNAc-T6, N-acetylgalactosaminyltransferase 6, Protein-UDP acetylgalactosaminyltransferase 6, UDP-GalNAc:polypeptide) (AP) discontinued

Sign In for Pricing
View Details
SRM Polyclonal Conjugated Antibody
orb1625712 100 µL

SRM Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
FAM136A (Biotin)
562098-01 50 µg

FAM136A (Biotin)

Sign In for Pricing
View Details