Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL2 Rabbit Polyclonal Antibody (HRP)

HHIPL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1822L

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HHIPL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGKCKYKPVPVRTKSKRIPFRPLAKTVLDLLKEQSEKAARKSSSATLASG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079022

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RPS21 Pre-designed siRNA Set A
SI014051A 1 Each

Human RPS21 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal FAM83G Antibody [DyLight 488]
NBP2-32191G 0.1 mL

Rabbit Polyclonal FAM83G Antibody [DyLight 488]

Sign In for Pricing
View Details
Mouse Monoclonal ATG5 Antibody (ATG5/2553)
NBP3-07880-20ug 20 µg

Mouse Monoclonal ATG5 Antibody (ATG5/2553)

Sign In for Pricing
View Details
N- (4-Chlorobenzyl) -2- (1-cyclohexen-1-yl) -1-ethanamine hydrochloride
sc-330001 500 mg

N- (4-Chlorobenzyl) -2- (1-cyclohexen-1-yl) -1-ethanamine hydrochloride

Sign In for Pricing
View Details
C6orf132 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-15218R-BF555 100 µL

C6orf132 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
GRIM19 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61922R-PE-Cy5.5 100 µL

GRIM19 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details