Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA14 Rabbit Polyclonal Antibody (Biotin)

HSPA14 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSP70-4, HSP70L1

UniProt

Q0VDF9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HSPA14

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSSSDPQAQKYIAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPSA AAV Vector (Mouse) (CMV)
42659104 1 µg

RPSA AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
RBPMS2, ID (RBPMS2, RNA-binding protein with multiple splicing 2)
MBS648416-01 0.2 mL

RBPMS2, ID (RBPMS2, RNA-binding protein with multiple splicing 2)

Sign In for Pricing
View Details
RBPMS2, ID (RBPMS2, RNA-binding protein with multiple splicing 2)
MBS648416-02 5x 0.2 mL

RBPMS2, ID (RBPMS2, RNA-binding protein with multiple splicing 2)

Sign In for Pricing
View Details
Anti-Desmoglein-3 (Squamous Cell Marker) Monoclonal Antibody (Clone: DSG3/2837)
36-2186-100 100 µg

Anti-Desmoglein-3 (Squamous Cell Marker) Monoclonal Antibody (Clone: DSG3/2837)

Sign In for Pricing
View Details
MCAM Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
28197064 1.0 µg DNA

MCAM Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Hoxd11 shRNA (UAS) - Lentiviral mouse Hoxd11 shRNA (UAS) (25)
GTR15195809 1 Vial

Lentiviral mouse Hoxd11 shRNA (UAS) - Lentiviral mouse Hoxd11 shRNA (UAS) (25)

Sign In for Pricing
View Details